Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIY RCNGTDIYKDKESTVQVHYRMCQSCVELD
    • Molecular weight
      34 kDa
    • Amino acids
      22 to 100
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD3 antigen delta subunit
    • CD3 delta
    • CD3d
    • CD3d antigen delta polypeptide (TiT3 complex)
    • CD3d molecule delta (CD3-TCR complex)
    • CD3D_HUMAN
    • IMD19
    • OKT3 delta chain
    • T cell receptor T3 delta chain
    • T-cell receptor T3 delta chain
    • T-cell surface glycoprotein CD3 delta chain
    • T3D
    see all
  • Function
    The CD3 complex mediates signal transduction.
  • Involvement in disease
    Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities
    Contains 1 ITAM domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human CD3D protein images

  • ab112261 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD3D protein (ab112261)

ab112261 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up