Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP04234
    • SpeciesHuman
    • SequenceMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGT LLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD PATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQ PLRDRDDAQYSHLGGNWARNK
    • Molecular weight45 kDa including tags
    • Amino acids1 to 171

Specifications

Our Abpromise guarantee covers the use of ab114152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114152 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD3d
    • CD3D_HUMAN
    • T-cell receptor T3 delta chain
    • T-cell surface glycoprotein CD3 delta chain
  • FunctionThe CD3 complex mediates signal transduction.
  • Involvement in diseaseDefects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similaritiesContains 1 ITAM domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD3D protein images

  • 12.5% SDS-PAGE analysis of ab114152, stained with Coomassie Blue.

References for Recombinant Human CD3D protein (ab114152)

ab114152 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"