Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKW NLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      23 to 111
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD3 gamma
    • CD3-GAMMA
    • CD3g
    • CD3g antigen gamma polypeptide
    • CD3g antigen gamma polypeptide (TiT3 complex)
    • CD3g molecule gamma
    • CD3g molecule gamma (CD3 TCR complex)
    • CD3G_HUMAN
    • FLJ17620
    • FLJ17664
    • FLJ79544
    • FLJ94613
    • MGC138597
    • T cell antigen receptor complex gamma subunit of T3
    • T-cell receptor T3 gamma chain
    • T-cell surface glycoprotein CD3 gamma chain
    • T3G
    see all
  • Function
    The CD3 complex mediates signal transduction.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Domain
    A di-leucine motif and a tyrosine-based motif are individually sufficient to induce both endocytosis and delivery to lysosomes.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab112261 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up