Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09693
    • SpeciesHuman
    • SequenceQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKW NLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
    • Molecular weight35 kDa including tags
    • Amino acids23 to 111
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD3 gamma
    • CD3-GAMMA
    • CD3g
    • CD3g antigen gamma polypeptide
    • CD3g antigen gamma polypeptide (TiT3 complex)
    • CD3g molecule gamma
    • CD3g molecule gamma (CD3 TCR complex)
    • CD3G_HUMAN
    • FLJ17620
    • FLJ17664
    • FLJ79544
    • FLJ94613
    • MGC138597
    • T cell antigen receptor complex gamma subunit of T3
    • T-cell receptor T3 gamma chain
    • T-cell surface glycoprotein CD3 gamma chain
    • T3G
    see all
  • FunctionThe CD3 complex mediates signal transduction.
  • Sequence similaritiesContains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • DomainA di-leucine motif and a tyrosine-based motif are individually sufficient to induce both endocytosis and delivery to lysosomes.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD3G protein images

  • ab112261 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD3G protein (ab112262)

ab112262 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"