Recombinant human CD4 protein (ab111463)

Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected Sf9 cells
  • Amino Acid Sequence
    • AccessionP01730
    • SpeciesHuman
    • SequenceKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGL TANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPL AFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVLPTW
    • Amino acids26 to 390

Specifications

Our Abpromise guarantee covers the use of ab111463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityImmune reactive in ELISA using monoclonal anti CD4 in gpl2O capture ELISA assays.
  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Purity by HPLC and SDS-PAGE is greater than 90%.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.00
    Constituents: 0.14% Sodium phosphate, 0.01% Tween, 1.76% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CD 4
    • CD4
    • CD4 (L3T4)
    • CD4 antigen
    • CD4 antigen (p55)
    • CD4 molecule
    • CD4 receptor
    • CD4+ Lymphocyte deficiency, included
    • CD4_HUMAN
    • CD4mut
    • L3T4
    • Leu3
    • Ly-4
    • Lymphocyte antigen CD4
    • MGC165891
    • OTTHUMP00000238897
    • p55
    • T cell antigen T4
    • T cell antigen T4/LEU3
    • T cell differentiation antigen L3T4
    • T cell OKT4 deficiency, included
    • T cell surface antigen T4/Leu 3
    • T cell surface antigen T4/Leu3
    • T cell surface glycoprotein CD4
    • T-cell surface antigen T4/Leu-3
    • T-cell surface glycoprotein CD4
    • W3/25
    • W3/25 antigen
    see all
  • FunctionAccessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
  • Sequence similaritiesContains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.
  • Cellular localizationCell membrane. Localizes to lipid rafts. Removed from plasma membrane by HIV-1 Nef protein that increases clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Cell surface expression is also down-modulated by HIV-1 Envelope polyprotein gp160 that interacts with, and sequesters CD4 in the endoplasmic reticulum.
  • Information by UniProt

References for Recombinant human CD4 protein (ab111463)

ab111463 has not yet been referenced specifically in any publications.

Product Wall

Thank you for calling Abcam on Friday. For CD4, I have found the following set Protein: ab111463, fragment from 29-390. Antibodies: ab67480, aa7****                      ab51312, aa******* I know that the antibodies bind very close to each other, but t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"