Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGL TANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPL AFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVLPTW
    • Molecular weight
      42 kDa including tags
    • Amino acids
      26 to 390
    • Tags
      His tag C-Terminus
    • Additional sequence information
      (AAH25782).

Specifications

Our Abpromise guarantee covers the use of ab221226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, PBS

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD 4
    • CD4
    • CD4 (L3T4)
    • CD4 antigen
    • CD4 antigen (p55)
    • CD4 molecule
    • CD4 receptor
    • CD4+ Lymphocyte deficiency, included
    • CD4_HUMAN
    • CD4mut
    • L3T4
    • Leu3
    • Ly-4
    • Lymphocyte antigen CD4
    • MGC165891
    • OTTHUMP00000238897
    • p55
    • T cell antigen T4
    • T cell antigen T4/LEU3
    • T cell differentiation antigen L3T4
    • T cell OKT4 deficiency, included
    • T cell surface antigen T4/Leu 3
    • T cell surface antigen T4/Leu3
    • T cell surface glycoprotein CD4
    • T-cell surface antigen T4/Leu-3
    • T-cell surface glycoprotein CD4
    • W3/25
    • W3/25 antigen
    see all
  • Function
    Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
  • Sequence similarities
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.
  • Cellular localization
    Cell membrane. Localizes to lipid rafts. Removed from plasma membrane by HIV-1 Nef protein that increases clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Cell surface expression is also down-modulated by HIV-1 Envelope polyprotein gp160 that interacts with, and sequesters CD4 in the endoplasmic reticulum.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221226 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 50 kDa due to glycosylation.

References

ab221226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up