Recombinant human CD40 protein (Fc Chimera Active) (ab83917)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      Theoretical Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNR ETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVL HRSC SPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLV VQQAG TNKTDVVCGPQDRLRRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids
      21 to 193
    • Additional sequence information
      Fused with the Fc region of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab83917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity: The ED50 of ab83917 is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.
  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • AI326936
    • B cell associated molecule CD40
    • B cell surface antigen CD40
    • B cell-associated molecule
    • B-cell surface antigen CD40
    • Bp50
    • CD 40
    • CD40
    • CD40 antigen
    • CD40 antigen (TNF receptor superfamily member 5)
    • CD40 molecule
    • CD40 molecule, TNF receptor superfamily member 5
    • CD40 protein
    • CD40 type II isoform
    • CD40L receptor
    • CDw40
    • GP39
    • HIGM1
    • IGM
    • IMD3
    • MGC9013
    • Nerve growth factor receptor related B lymphocyte activation molecule
    • OTTHUMP00000031699
    • OTTHUMP00000031700
    • p50
    • T-BAM
    • TBAM
    • TNF receptor superfamily member 5
    • TNFRSF5
    • TNR5_HUMAN
    • TRAP
    • Tumor necrosis factor receptor superfamily , member 5
    • Tumor necrosis factor receptor superfamily member 5
    • Tumor necrosis factor receptor superfamily member 5 precursor
    • Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
    see all
  • Function
    Receptor for TNFSF5/CD40LG.
  • Tissue specificity
    B-cells and in primary carcinomas.
  • Involvement in disease
    Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation.
  • Sequence similarities
    Contains 4 TNFR-Cys repeats.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83917 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83917
    Lane 2: ab83917 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83917 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
  • Anti-CD40 antibody (ab13545) at 1/1000 dilution + Recombinant human CD40 protein (Fc Chimera Active) (ab83917) at 1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Observed band size : 72 kDa (why is the actual band size different from the predicted?)


    Exposure time : 8 minutes

References

ab83917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up