Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14770
    • SpeciesHuman
    • SequenceMPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALP ARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWL EDRTPEALLQVRCASPSLAAHGPLGRLTGYQLGSCGWQLQASWVRPGVLW DVALVTVAALGLALLAGLLCATTEALD
    • Molecular weight46 kDa including tags
    • Amino acids1 to 177

Specifications

Our Abpromise guarantee covers the use of ab114525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD42a
    • Glycoprotein 9
    • Glycoprotein IX
    • Glycoprotein IX (platelet)
    • Glycoprotein IX precursor
    • GP IX
    • GP-IX
    • GP9
    • GPIX
    • GPIX_HUMAN
    • Platelet glycoprotein IX
    see all
  • FunctionThe GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. GP-IX may provide for membrane insertion and orientation of GP-Ib.
  • Involvement in diseaseDefects in GP9 are a cause of Bernard-Soulier syndrome (BSS) [MIM:231200]; also known as giant platelet disease (GPD). BSS patients have unusually large platelets and have a clinical bleeding tendency.
  • Sequence similaritiesContains 1 LRR (leucine-rich) repeat.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD42a protein images

  • 12.5% SDS-PAGE showing ab114525 at approximately 45.54kDa stained with Coomassie Blue.

References for Recombinant Human CD42a protein (ab114525)

ab114525 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"