Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLM PYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPAL TVLDVPFNRL
    • Amino acids
      19 to 128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen CD42b alpha
    • BDPLT1
    • BDPLT3
    • BSS
    • CD 42b
    • CD42B
    • CD42b alpha
    • CD42b antigen
    • DBPLT3
    • GLYCOCALICIN
    • Glycoprotein Ib (platelet) alpha polypeptide
    • Glycoprotein Ibalpha
    • GP Ib alpha
    • GP1B
    • GP1BA
    • GPIb alpha
    • GPIbA
    • MGC34595
    • Platelet glycoprotein Ib alpha chain
    • Platelet glycoprotein Ib alpha polypeptide
    • Platelet membrane glycoprotein 1b alpha subunit
    • VWDP
    see all
  • Relevance
    CD42b is a platelet activation marker involved in the process of coagulation as an aggregating factor. It interacts with extracellular matrix as well as with adhesion molecules. Its expression and activation seems to be regulated by VEGF and PDGF.
  • Cellular localization
    Cell Membrane

Images

  • ab158558 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up