Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSIT SDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSI KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAP VTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGT TGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDE NSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 400

Specifications

Our Abpromise guarantee covers the use of ab152704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl. <
  • Concentration information loading...
  • Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names
      • CD 43
      • CD43
      • CD43 antigen
      • Galactoglycoprotein
      • GALGP
      • GPL 115
      • GPL115
      • Human gene for sialophorin
      • Leucocyte sialoglycoprotein
      • LEUK_HUMAN
      • Leukocyte large sialoglycoprotein
      • Leukocyte sialoglycoprotein
      • Leukosialin
      • LSN
      • Ly-48
      • Sialophorin
      • sialophorin (gpL115, leukosialin, CD43)
      • Spn
      see all
    • Function
      One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochemical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter receptor for SN/Siglec-1 (By similarity). During T-cell activation is actively removed from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response.
    • Tissue specificity
      Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
    • Post-translational
      modifications
      Glycosylated; has a high content of sialic acid and O-linked carbohydrate structures.
    • Cellular localization
      Membrane.
    • Information by UniProt

    Images

    • 12.5% SDS-PAGE analysis of ab152704 stained with Coomassie Blue.

    References

    ab152704 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab152704.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Get resources and offers direct to your inbox Sign up