Recombinant Human CD44 protein (Fc Chimera) (ab185865)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYP SNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIP VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      49 kDa including tags
    • Amino acids
      21 to 220
    • Additional sequence information
      Fused with a Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab185865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Aliquot the reconstituted solution and store at < -20°C.

General Info

  • Alternative names
    • LHR
    • BA-1
    • CD 44
    • CD44
    • CD44 antigen
    • CD44 molecule
    • CD44 molecule (Indian blood group)
    • CD44_HUMAN
    • CDw44
    • Cell surface glycoprotein CD44
    • chondroitin sulfate proteoglycan 8
    • CSPG8
    • ECMR-III
    • Epican
    • Extracellular matrix receptor III
    • GP90 lymphocyte homing/adhesion receptor
    • HCELL
    • hematopoietic cell E- and L-selectin ligand
    • Heparan sulfate proteoglycan
    • Hermes antigen
    • homing function and Indian blood group system
    • HSA
    • HUTCH-I
    • HUTCH1
    • Hyaluronate receptor
    • IN
    • INLU-related p80 Glycoprotein
    • MC56
    • MDU2
    • MDU3
    • MGC10468
    • MIC4
    • MUTCH1
    • PGP-1
    • PGP-I
    • PGP1
    • Phagocytic glycoprotein 1
    • Phagocytic glycoprotein I
    • Soluble CD44
    see all
  • Function
    Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. Also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events.
  • Tissue specificity
    Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.
  • Sequence similarities
    Contains 1 Link domain.
  • Domain
    The lectin-like LINK domain is responsible for hyaluronan binding.
  • Post-translational
    modifications
    Proteolytically cleaved in the extracellular matrix by specific proteinases (possibly MMPs) in several cell lines and tumors.
    N-glycosylated.
    O-glycosylated; contains more-or-less-sulfated chondroitin sulfate glycans, whose number may affect the accessibility of specific proteinases to their cleavage site(s).
    Phosphorylated; activation of PKC results in the dephosphorylation of Ser-706 (constitutive phosphorylation site), and the phosphorylation of Ser-672.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab185865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up