Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLP ENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQ KEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRA SWEAWGTLGEEERKTSGQV
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 169

Specifications

Our Abpromise guarantee covers the use of ab114535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen CD48
    • B cell membrane protein
    • B lymphocyte activation marker BLAST 1
    • B-cell activation marker
    • B-lymphocyte activation marker BLAST-1
    • BCM 1 surface antigen
    • BCM1
    • BCM1 surface antigen
    • BLAST
    • BLAST 1
    • BLAST1
    • CD 48
    • CD48
    • CD48 antigen
    • CD48 antigen (B cell membrane protein)
    • CD48 molecule
    • CD48 protein
    • CD48_HUMAN
    • hCD48
    • Leucocyte antigen MEM 102
    • Leukocyte antigen MEM-102
    • mCD48
    • MEM 102
    • MEM-102
    • MEM102
    • Signaling lymphocytic activation molecule 2
    • SLAM family member 2
    • SLAMF 2
    • SLAMF2
    • TCT.1
    see all
  • Function
    Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114535 at approximately 44.33kDa stained with Coomassie Blue.

References

ab114535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up