Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09326
    • SpeciesHuman
    • SequenceMCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLP ENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQ KEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRA SWEAWGTLGEEERKTSGQV
    • Molecular weight44 kDa including tags
    • Amino acids1 to 169

Specifications

Our Abpromise guarantee covers the use of ab114535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen CD48
    • B cell membrane protein
    • B lymphocyte activation marker BLAST 1
    • B-cell activation marker
    • B-lymphocyte activation marker BLAST-1
    • BCM 1 surface antigen
    • BCM1
    • BCM1 surface antigen
    • BLAST
    • BLAST 1
    • BLAST1
    • CD 48
    • CD48
    • CD48 antigen
    • CD48 antigen (B cell membrane protein)
    • CD48 molecule
    • CD48 protein
    • CD48_HUMAN
    • hCD48
    • Leucocyte antigen MEM 102
    • Leukocyte antigen MEM-102
    • mCD48
    • MEM 102
    • MEM-102
    • MEM102
    • Signaling lymphocytic activation molecule 2
    • SLAM family member 2
    • SLAMF 2
    • SLAMF2
    • TCT.1
    see all
  • FunctionLigand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CD48 protein images

  • 12.5% SDS-PAGE showing ab114535 at approximately 44.33kDa stained with Coomassie Blue.

References for Recombinant Human CD48 protein (ab114535)

ab114535 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"