Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP06127
    • SpeciesHuman
    • SequenceKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNE YSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL
    • Molecular weight36 kDa including tags
    • Amino acids403 to 495

Specifications

Our Abpromise guarantee covers the use of ab114471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114471 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CD 5
    • CD5
    • CD5 antigen
    • CD5 antigen (p56 62)
    • CD5 molecule
    • CD5_HUMAN
    • LEU1
    • LyA
    • Lymphocyte antigen T1/Leu-1
    • OTTHUMP00000236973
    • T-cell surface glycoprotein CD5
    • T1
    see all
  • FunctionMay act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
  • Sequence similaritiesContains 3 SRCR domains.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD5 protein images

  • ab114471 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human CD5 protein (ab114471)

ab114471 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"