Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNE YSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      403 to 495

Specifications

Our Abpromise guarantee covers the use of ab114471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114471 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CD 5
    • CD5
    • CD5 antigen
    • CD5 antigen (p56 62)
    • CD5 molecule
    • CD5_HUMAN
    • LEU1
    • LyA
    • Lymphocyte antigen T1/Leu-1
    • OTTHUMP00000236973
    • T-cell surface glycoprotein CD5
    • T1
    see all
  • Function
    May act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
  • Sequence similarities
    Contains 3 SRCR domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114471 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up