Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKG SQWSDIEEFC NRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLT CLQNLKWSTA VEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFC LISGSSVQWS DPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHS IYCTVNNDEG EWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPN AQATRSTPVS RTTKHFHETTPNKGSGTTS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      35 to 353
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Bioactivity: Measured by binding ability in a functional ELISA. When ab168708 is coated at 1 µg/mL (100 µL/well), the concentration of recombinant Human CD97 that produces 50% of the optimal binding response is found to be approximately 0.15-2.0 µg/mL.
  • Applications

    SDS-PAGE

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water or buffer. Please refer to the batch CoA for more details. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD 55
    • CD55
    • CD55 antigen
    • CD55 Cromer blood group system
    • CD55 molecule
    • CD55 molecule (Cromer blood group)
    • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
    • Cd55a
    • Complement decay accelerating factor
    • Complement decay-accelerating factor
    • Complement decay-accelerating factor, GPI-anchored
    • CR
    • CROM
    • Cromer Blood Group antigen
    • Cromer blood group system
    • DAF
    • Daf-GPI
    • DAF_HUMAN
    • Daf1
    • Dcay accelerating factor for complement (CD55, Cromer blood group system)
    • Decay accelarating factor 1, isoform CRA_a
    • Decay accelerating factor (GPI-form)
    • Decay Accelerating Factor for Complement
    • Decay accelerating factor GPI-form
    • Decay accelerating factor soluble-form
    • GPI-DAF
    • TC
    see all
  • Function
    This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.
  • Tissue specificity
    Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
  • Sequence similarities
    Belongs to the receptors of complement activation (RCA) family.
    Contains 4 Sushi (CCP/SCR) domains.
  • Domain
    The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3.
  • Post-translational
    modifications
    The Ser/Thr-rich domain is heavily O-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • The purity of ab168708 was determined by SDS-PAGE of reduced CD55 and staining overnight with Coomassie Blue

References

ab168708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up