Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQE SSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV
    • Amino acids
      235 to 332
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-glucuronyltransferase
    • 3-glucuronyltransferase 1
    • B3GA1_HUMAN
    • B3gat1
    • Beta 1 3 glucuronyltransferase 1
    • Beta-1
    • Beta-1,3-glucuronyltransferase 1
    • CD 57
    • CD57
    • CD57 antigen
    • Galactosylgalactosylxylosylprotein 3 beta glucuronosyltransferase 1
    • Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
    • GlcAT P
    • GlcAT-P
    • GLCATP
    • GlcUAT P
    • GlcUAT-P
    • GlcUATP
    • Glucuronosyltransferase P
    • HNK 1
    • HNK1
    • LEU 7
    • LEU7
    • LEU7 antigen
    • NK 1
    • NK1
    • UDP GlcUA glycoprotein beta 1 3 glucuronyltransferase
    • UDP-GlcUA:glycoprotein beta-1
    see all
  • Function
    Involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on glycoproteins. Can also play a role in glycosaminoglycan biosynthesis. Substrates include asialo-orosomucoid (ASOR), asialo-fetuin, and asialo-neural cell adhesion molecule. Requires sphingomyelin for activity: stearoyl-sphingomyelin was the most effective, followed by palmitoyl-sphingomyelin and lignoceroyl-sphingomyelin. Activity was demonstrated only for sphingomyelin with a saturated fatty acid and not for that with an unsaturated fatty acid, regardless of the length of the acyl group.
  • Tissue specificity
    Mainly expressed in the brain.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 43 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab153281 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up