Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVL IQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      41 to 140
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAC-11
    • AIM
    • API6
    • APOPTOSIS INHIBITOR 6
    • APOPTOSIS INHIBITOR OF MACROPHAGES
    • CD5 antigen like (scavenger receptor cysteine rich family)
    • CD5 antigen-like
    • Cd5l
    • CD5L_HUMAN
    • CT 2
    • CT-2
    • Highly similar to ANTIGEN WC1.1 [Bos taurus]
    • IgM associated peptide
    • IgM-associated peptide
    • Pdp
    • PRO229
    • SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY
    • SP ALPHA
    • SP-alpha
    • Spalpha
    see all
  • Function
    May play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis.
  • Tissue specificity
    Expressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues.
  • Sequence similarities
    Contains 3 SRCR domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human CD5L protein images

  • 12.5% SDS-PAGE image showing ab114645 Stained with Coomassie Blue.

References for Recombinant Human CD5L protein (ab114645)

ab114645 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up