Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVL IQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      41 to 140
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAC-11
    • AIM
    • API6
    • APOPTOSIS INHIBITOR 6
    • APOPTOSIS INHIBITOR OF MACROPHAGES
    • CD5 antigen like (scavenger receptor cysteine rich family)
    • CD5 antigen-like
    • Cd5l
    • CD5L_HUMAN
    • CT 2
    • CT-2
    • Highly similar to ANTIGEN WC1.1 [Bos taurus]
    • IgM associated peptide
    • IgM-associated peptide
    • Pdp
    • PRO229
    • SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY
    • SP ALPHA
    • SP-alpha
    • Spalpha
    see all
  • Function
    May play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis.
  • Tissue specificity
    Expressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues.
  • Sequence similarities
    Contains 3 SRCR domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114645 Stained with Coomassie Blue.

References

ab114645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up