Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43866
    • SpeciesHuman
    • SequenceQKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVL IQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
    • Molecular weight37 kDa including tags
    • Amino acids41 to 140
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAC-11
    • AIM
    • API6
    • APOPTOSIS INHIBITOR 6
    • APOPTOSIS INHIBITOR OF MACROPHAGES
    • CD5 antigen like (scavenger receptor cysteine rich family)
    • CD5 antigen-like
    • Cd5l
    • CD5L_HUMAN
    • CT 2
    • CT-2
    • Highly similar to ANTIGEN WC1.1 [Bos taurus]
    • IgM associated peptide
    • IgM-associated peptide
    • Pdp
    • PRO229
    • SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY
    • SP ALPHA
    • SP-alpha
    • Spalpha
    see all
  • FunctionMay play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis.
  • Tissue specificityExpressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues.
  • Sequence similaritiesContains 3 SRCR domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human CD5L protein images

  • 12.5% SDS-PAGE image showing ab114645 Stained with Coomassie Blue.

References for Recombinant Human CD5L protein (ab114645)

ab114645 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"