Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFSPSGVRLVGGLHRCEGRVEVE QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVL IQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKR CNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED PFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKS LSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQED VAVICSG
    • Molecular weight
      39 kDa including tags
    • Amino acids
      20 to 347
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site tag (29aa) fusion at its N-terminal (NP_005885.1).

Specifications

Our Abpromise guarantee covers the use of ab182837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182837 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • AAC-11
    • AIM
    • API6
    • APOPTOSIS INHIBITOR 6
    • APOPTOSIS INHIBITOR OF MACROPHAGES
    • CD5 antigen like (scavenger receptor cysteine rich family)
    • CD5 antigen-like
    • Cd5l
    • CD5L_HUMAN
    • CT 2
    • CT-2
    • Highly similar to ANTIGEN WC1.1 [Bos taurus]
    • IgM associated peptide
    • IgM-associated peptide
    • Pdp
    • PRO229
    • SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY
    • SP ALPHA
    • SP-alpha
    • Spalpha
    see all
  • Function
    May play a role in the regulation of the immune system. Seems to play a role as an inhibitor of apoptosis.
  • Tissue specificity
    Expressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues.
  • Sequence similarities
    Contains 3 SRCR domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab182837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up