Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP30203
    • SpeciesHuman
    • SequenceCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAAR VLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM
    • Molecular weight36 kDa including tags
    • Amino acids308 to 400

Specifications

Our Abpromise guarantee covers the use of ab116984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD_antigen=CD6
    • CD6
    • CD6 antigen Tp120
    • CD6 molecule
    • CD6_HUMAN
    • FLJ44171
    • OX52
    • T cell differentiation antigen CD6
    • T-cell differentiation antigen CD6
    • T12
    • TP120
    see all
  • FunctionInvolved in cell adhesion. Binds to CD166.
  • Tissue specificityExpressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.
  • Sequence similaritiesContains 3 SRCR domains.
  • Post-translational
    modifications
    After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.
    Contains intrachain disulfide bond(s).
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD6 protein images

  • 12.5% SDS-PAGE showing ab116984 at approximately 35.86kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CD6 protein (ab116984)

ab116984 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"