Overview

Description

  • Nature
    Recombinant
  • Source
    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYW IGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKD VGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSG LKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMET MQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFD CEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSP AGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS NPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNE KPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGST QLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACP EGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
    • Molecular weight
      59 kDa
    • Amino acids
      22 to 556

Specifications

Our Abpromise guarantee covers the use of ab104357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to support adhesion of U937 cells, a Human hystiocytic lymphoma cell line.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity : Greater than 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • Form
    Lyophilised
  • Additional notes
    Measured by its ability to support adhesion of U937 cells, a Human hystiocytic lymphoma cell line.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None
    Constituents: 10mM Sodium phosphate, pH 7.0

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • CD26E
    • CD62 antigen-like family member E
    • CD62E
    • E selectin
    • E-selectin
    • ELAM
    • ELAM-1
    • ELAM1
    • Endothelial adhesion molecule 1
    • Endothelial leukocyte adhesion molecule 1
    • ESEL
    • LECAM2
    • Leukocyte-endothelial cell adhesion molecule 2
    • LYAM2_HUMAN
    • Sele
    • Selectin E
    see all
  • Function
    Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
  • Sequence similarities
    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 6 Sushi (CCP/SCR) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

References for Recombinant Human CD62E protein (ab104357)

ab104357 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up