Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYW IGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKD VGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSG LKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMET MQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFD CEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSP AGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTA LSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWD NEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHG STQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFA CPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
    • Molecular weight
      60 kDa including tags
    • Amino acids
      22 to 556
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by the ability of the immobilized protein to support the adhesion of U937 Human histiocytic lymphoma cells. When 5 x 104cells/well are added to Human CD62E coated plates (2 µg/mL with 100 µL/well), >80% cells will adhere after 1 hour incubation at 37°C.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab167744 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measured by the ability of the immobilized protein to support the adhesion of U937 Human histiocytic lymphoma cells. When 5 x 104cells/well are added to Human CD62E coated plates (2 µg/mL with 100 µL/well), >80% cells will adhere after 1 hour incubation at 37°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is strongly recommended to reconstitute the lyophilized ab167744 with 2000 µl sterile deionized water to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD26E
    • CD62 antigen-like family member E
    • CD62E
    • E selectin
    • E-selectin
    • ELAM
    • ELAM-1
    • ELAM1
    • Endothelial adhesion molecule 1
    • Endothelial leukocyte adhesion molecule 1
    • ESEL
    • LECAM2
    • Leukocyte-endothelial cell adhesion molecule 2
    • LYAM2_HUMAN
    • Sele
    • Selectin E
    see all
  • Function
    Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
  • Sequence similarities
    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 6 Sushi (CCP/SCR) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167744 and staining overnight with Coomassie Blue. Protein migrates as 110 kDa in reduced SDS-PAGE resulting from glycosylation.

References

ab167744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up