Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTD CWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYY WIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNK DAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYY GPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIE ETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTF ICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIP VAVMVTAFSGLAFIIWLARRLKKGM
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 375

Specifications

Our Abpromise guarantee covers the use of ab132972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A.11
    • AI528707
    • CD62 antigen ligand
    • CD62 antigen-like family member L
    • CD62L
    • gp90-MEL
    • IgA nephropathy, susceptibility to, included
    • L Selectin
    • L-selectin
    • LAM-1
    • LAM1
    • LECAM1
    • LEU8
    • Leukocyte adhesion molecule 1
    • Leukocyte surface antigen Leu-8
    • Leukocyte-endothelial cell adhesion molecule 1
    • Lnhr
    • LSEL
    • Ly-22
    • Ly-m22
    • Lyam-1
    • LYAM1
    • LYAM1_HUMAN
    • Lymph node homing receptor
    • Lymphocyte adhesion molecule 1
    • Lymphocyte antigen 22
    • Lymphocyte surface MEL-14 antigen
    • MEL-14
    • Pln homing receptor
    • PLNHR
    • Selectin L
    • Selectin, lymphocyte
    • SELL
    • TQ1
    see all
  • Function
    Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
  • Tissue specificity
    Expressed in B cell lines and T lymphocytes.
  • Sequence similarities
    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132972 stained with Coomassie Blue.

References

ab132972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up