Recombinant Human CD62L protein (Fc Chimera) (ab83824)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      Theoretical Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSY YWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRN KDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGY YGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGI EETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACT FICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDWIPKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids
      1 to 343
    • Additional sequence information
      Fused with the Fc region of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab83824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • A.11
    • AI528707
    • CD62 antigen ligand
    • CD62 antigen-like family member L
    • CD62L
    • gp90-MEL
    • IgA nephropathy, susceptibility to, included
    • L Selectin
    • L-selectin
    • LAM-1
    • LAM1
    • LECAM1
    • LEU8
    • Leukocyte adhesion molecule 1
    • Leukocyte surface antigen Leu-8
    • Leukocyte-endothelial cell adhesion molecule 1
    • Lnhr
    • LSEL
    • Ly-22
    • Ly-m22
    • Lyam-1
    • LYAM1
    • LYAM1_HUMAN
    • Lymph node homing receptor
    • Lymphocyte adhesion molecule 1
    • Lymphocyte antigen 22
    • Lymphocyte surface MEL-14 antigen
    • MEL-14
    • Pln homing receptor
    • PLNHR
    • Selectin L
    • Selectin, lymphocyte
    • SELL
    • TQ1
    see all
  • Function
    Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
  • Tissue specificity
    Expressed in B cell lines and T lymphocytes.
  • Sequence similarities
    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83824 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83824
    Lane 2: ab83824 treated with PNGase F to remove potential N-linked glycans
    10 μg protein loaded per lane; Deep Purple™ stained.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans.

References

ab83824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up