Recombinant Human CD62L protein (Fc Chimera) (ab83824)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP14151
    • SpeciesHuman
    • SequenceTheoretical Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSY YWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRN KDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGY YGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGI EETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACT FICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDWIPKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids1 to 343
    • Additional sequence informationFused with the Fc region of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab83824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • A.11
    • AI528707
    • CD62 antigen ligand
    • CD62 antigen-like family member L
    • CD62L
    • gp90-MEL
    • IgA nephropathy, susceptibility to, included
    • L Selectin
    • L-selectin
    • LAM-1
    • LAM1
    • LECAM1
    • LEU8
    • Leukocyte adhesion molecule 1
    • Leukocyte surface antigen Leu-8
    • Leukocyte-endothelial cell adhesion molecule 1
    • Lnhr
    • LSEL
    • Ly-22
    • Ly-m22
    • Lyam-1
    • LYAM1
    • LYAM1_HUMAN
    • Lymph node homing receptor
    • Lymphocyte adhesion molecule 1
    • Lymphocyte antigen 22
    • Lymphocyte surface MEL-14 antigen
    • MEL-14
    • Pln homing receptor
    • PLNHR
    • Selectin L
    • Selectin, lymphocyte
    • SELL
    • TQ1
    see all
  • FunctionCell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
  • Tissue specificityExpressed in B cell lines and T lymphocytes.
  • Sequence similaritiesBelongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD62L protein (Fc Chimera) images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83824 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83824
    Lane 2: ab83824 treated with PNGase F to remove potential N-linked glycans
    10 μg protein loaded per lane; Deep Purple™ stained.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans.

References for Recombinant Human CD62L protein (Fc Chimera) (ab83824)

ab83824 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"