Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31997
    • SpeciesHuman
    • SequenceMGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKE VLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRET IYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSIS SNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYH AGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACH TTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
    • Molecular weight64 kDa including tags
    • Amino acids1 to 349

Specifications

Our Abpromise guarantee covers the use of ab114417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carcinoembryonic antigen CGM6
    • Carcinoembryonic antigen gene family member 6
    • Carcinoembryonic antigen related cell adhesion molecule 8
    • Carcinoembryonic antigen-related cell adhesion molecule 8
    • CD 66b
    • CD 67
    • CD66b
    • CD66b antigen
    • CD67
    • CD67 antigen
    • CEACAM 8
    • CEACAM8
    • CEAM8_HUMAN
    • CGM 6
    • CGM6
    • NCA 95
    • NCA95
    • Non-specific cross-reacting antigen NCA-95
    • Nonspecific cross reacting antigen NCA 95
    • Nonspecific cross reacting antigen NCA95
    see all
  • Tissue specificityExpressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CD66b protein images

  • ab114417 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD66b protein (ab114417)

ab114417 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"