Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVI SNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEV TGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQS LPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVL YGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKL FIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      35 to 319
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab167762 is lyophilised from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilise for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Carcinoembryonic antigen CGM6
    • Carcinoembryonic antigen gene family member 6
    • Carcinoembryonic antigen related cell adhesion molecule 8
    • Carcinoembryonic antigen-related cell adhesion molecule 8
    • CD 66b
    • CD 67
    • CD66b
    • CD66b antigen
    • CD67
    • CD67 antigen
    • CEACAM 8
    • CEACAM8
    • CEAM8_HUMAN
    • CGM 6
    • CGM6
    • NCA 95
    • NCA95
    • Non-specific cross-reacting antigen NCA-95
    • Nonspecific cross reacting antigen NCA 95
    • Nonspecific cross reacting antigen NCA95
    see all
  • Tissue specificity
    Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167763 stained overnight with Coomassie Blue.

References

ab167763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up