Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ07108
    • SpeciesHuman
    • SequenceVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGRE EHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKN LYWICNKPYK
    • Molecular weight38 kDa including tags
    • Amino acids90 to 199

Specifications

Our Abpromise guarantee covers the use of ab114349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activation inducer molecule
    • Activation inducer molecule (AIM/CD69)
    • AIM
    • BL-AC/P26
    • BLAC/P26
    • C-type lectin domain family 2 member C
    • CD69
    • CD69 antigen
    • CD69 antigen (p60, early T-cell activation antigen)
    • CD69 molecule
    • CD69_HUMAN
    • CLEC2C
    • EA1
    • Early activation antigen CD69
    • Early lymphocyte activation antigen
    • Early T cell activation antigen p60
    • Early T-cell activation antigen p60
    • GP32/28
    • Leu23
    • Leukocyte surface antigen Leu-23
    • MLR-3
    • MLR3
    • VEA
    • Very Early Activation Antigen
    see all
  • FunctionInvolved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
  • Tissue specificityExpressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • Developmental stageEarliest inducible cell surface glycoprotein acquired during lymphoid activation.
  • Post-translational
    modifications
    Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD69 protein images

  • ab114349 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD69 protein (ab114349)

ab114349 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"