Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09564
    • SpeciesHuman
    • SequencePGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDII YYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASAL PDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ
    • Molecular weight50 kDa including tags
    • Amino acids21 to 240

Specifications

Our Abpromise guarantee covers the use of ab114926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CD7
    • CD7 antigen
    • CD7 antigen (p41)
    • CD7 molecule
    • CD7_HUMAN
    • GP40
    • LEU 9
    • LEU9
    • p41 protein
    • T cell antigen CD7
    • T cell leukemia antigen
    • T cell surface antigen Leu 9
    • T-cell antigen CD7
    • T-cell leukemia antigen
    • T-cell surface antigen Leu-9
    • Tp 40
    • Tp40
    • TP41
    see all
  • FunctionNot yet known.
  • Sequence similaritiesContains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD7 protein images

  • ab114926 analyzed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD7 protein (ab114926)

ab114926 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"