Recombinant Human CD7 protein (denatured) (ab171591)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSAQEVQQSPHCTTVPVGASVNITCSTSG GLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMH RLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASAL PAPPTGSALPDPQTASALPDPPAASALP
    • Molecular weight
      19 kDa including tags
    • Amino acids
      26 to 180
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab171591 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • CD7
    • CD7 antigen
    • CD7 antigen (p41)
    • CD7 molecule
    • CD7_HUMAN
    • GP40
    • LEU 9
    • LEU9
    • p41 protein
    • T cell antigen CD7
    • T cell leukemia antigen
    • T cell surface antigen Leu 9
    • T-cell antigen CD7
    • T-cell leukemia antigen
    • T-cell surface antigen Leu-9
    • Tp 40
    • Tp40
    • TP41
    see all
  • Function
    Not yet known.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171591 at 3µg.

References

ab171591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up