Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGIC SPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDE TFFGVQWVRP
    • Amino acids
      84 to 193
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 27L
    • CD 70
    • CD27 L
    • CD27 LG
    • CD27 ligand
    • CD27-L
    • CD27L
    • CD27LG
    • CD70
    • CD70 antigen
    • CD70 molecule
    • CD70_HUMAN
    • Ki 24 antigen
    • Ki24 antigen
    • Surface antigen CD70
    • TNFSF 7
    • TNFSF7
    • Tumor necrosis factor (ligand) superfamily, member 7
    • Tumor necrosis factor ligand superfamily member 7
    see all
  • Function
    Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up