Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQL GQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQ SEEQQRRALEQKLSNMENRLKPFFTC
    • Molecular weight
      31 kDa
    • Amino acids
      117 to 226

Specifications

Our Abpromise guarantee covers the use of ab173028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • B cell differentiation antigen CD72
    • B-cell differentiation antigen CD72
    • CD_antigen=CD72
    • CD72
    • CD72 antigen
    • CD72 molecule
    • CD72_HUMAN
    • CD72b
    • CD72c
    • Ly-19
    • Ly-32
    • Ly-m19
    • Lyb-2
    • Lyb2
    • LYB2, mouse, homolog of
    • Lymphocyte antigen 32
    • MGC108873
    see all
  • Function
    Plays a role in B-cell proliferation and differentiation.
  • Tissue specificity
    Pre-B-cells and B-cells but not terminally differentiated plasma cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab173028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up