Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPN VLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGL IEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYT SKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDK LIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
    • Molecular weight
      52 kDa
    • Amino acids
      28 to 265
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 5' NT
    • 5' nucleotidase (CD73)
    • 5' nucleotidase precursor
    • 5' nucleotidase, ecto
    • 5' nucleotidase, ecto (CD73)
    • 5'-NT
    • 5'-nucleotidase
    • 5NTD_HUMAN
    • CD73
    • CD73 antigen
    • E5NT
    • Ecto 5' nucleotidase
    • Ecto-5'-nucleotidase
    • eN
    • eNT
    • NT
    • NT5
    • NT5E
    • NTE
    • Purine 5 Prime Nucleotidase
    see all
  • Function
    Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
  • Involvement in disease
    Defects in NT5E are the cause of calcification of joints and arteries (CAJA) [MIM:211800]. A condition characterized by adult-onset calcification of the lower extremity arteries, including the iliac, femoral and tibial arteries, and hand and foot capsule joints. Age of onset has been reported as early as the second decade of life, usually involving intense joint pain or calcification in the hands.
  • Sequence similarities
    Belongs to the 5'-nucleotidase family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab112335 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up