Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96B6O
    • SpeciesHuman
    • SequenceELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPN VLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGL IEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYT SKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDK LIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
    • Molecular weight52 kDa
    • Amino acids28 to 265
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 5' NT
    • 5' nucleotidase (CD73)
    • 5' nucleotidase precursor
    • 5' nucleotidase, ecto
    • 5' nucleotidase, ecto (CD73)
    • 5'-NT
    • 5'-nucleotidase
    • 5NTD_HUMAN
    • CD73
    • CD73 antigen
    • E5NT
    • Ecto 5' nucleotidase
    • Ecto-5'-nucleotidase
    • eN
    • eNT
    • NT
    • NT5
    • NT5E
    • NTE
    • Purine 5 Prime Nucleotidase
    see all
  • FunctionHydrolyzes extracellular nucleotides into membrane permeable nucleosides.
  • Involvement in diseaseDefects in NT5E are the cause of calcification of joints and arteries (CAJA) [MIM:211800]. A condition characterized by adult-onset calcification of the lower extremity arteries, including the iliac, femoral and tibial arteries, and hand and foot capsule joints. Age of onset has been reported as early as the second decade of life, usually involving intense joint pain or calcification in the hands.
  • Sequence similaritiesBelongs to the 5'-nucleotidase family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CD73 protein images

  • ab112335 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD73 protein (ab112335)

ab112335 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"