Recombinant Human CD73 protein (ab151934)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEP NVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEG LIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGY TSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMD KLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVP VVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINK WRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHA DETFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQL KGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLC TKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDIN VVSTYISKMKVIYPAVEGRIKVDHHHHHH
    • Molecular weight
      59 kDa including tags
    • Amino acids
      27 to 547
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
    ab151934 was 0.2 µM filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% Calcium chloride, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 5' NT
    • 5' nucleotidase (CD73)
    • 5' nucleotidase precursor
    • 5' nucleotidase, ecto
    • 5' nucleotidase, ecto (CD73)
    • 5'-NT
    • 5'-nucleotidase
    • 5NTD_HUMAN
    • CD73
    • CD73 antigen
    • E5NT
    • Ecto 5' nucleotidase
    • Ecto-5'-nucleotidase
    • eN
    • eNT
    • NT
    • NT5
    • NT5E
    • NTE
    • Purine 5 Prime Nucleotidase
    see all
  • Function
    Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
  • Involvement in disease
    Defects in NT5E are the cause of calcification of joints and arteries (CAJA) [MIM:211800]. A condition characterized by adult-onset calcification of the lower extremity arteries, including the iliac, femoral and tibial arteries, and hand and foot capsule joints. Age of onset has been reported as early as the second decade of life, usually involving intense joint pain or calcification in the hands.
  • Sequence similarities
    Belongs to the 5'-nucleotidase family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151934 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.



I can confirm you that ab151934 has a specific activity of 27827pmol/min/μg as measured by its ability to hydrolyze the 5’­phosphate group from the substrate adenosine­5’­mo...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up