Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALY TGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHW NWRTRLLGWV
    • Amino acids
      1 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 74
    • CD74
    • CD74 antigen
    • CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
    • CD74 molecule
    • CD74 molecule, major histocompatibility complex, class II invariant chain
    • CLIP
    • DHLAG
    • Gamma chain of class II antigens
    • HG2A_HUMAN
    • HLA class II histocompatibility antigen gamma chain
    • HLA DR antigens associated invariant chain
    • HLA DR gamma
    • HLA-DR antigens-associated invariant chain
    • HLA-DR-gamma
    • HLADG
    • HLADR antigens associated invariant chain
    • Ia antigen associated invariant chain
    • Ia antigen-associated invariant chain
    • Ia associated invariant chain
    • Ia gamma
    • Ii
    • Invariant polypeptide of major histocompatibility complex class II antigen associated
    • la-gamma
    • Major histocompatibility complex class II invariant chain
    • MHC HLA DR gamma chain
    • MHC HLA-DR gamma chain
    • p33
    • p35
    • Protein 41
    see all
  • Function
    Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
  • Sequence similarities
    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network. Endosome. Lysosome. Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.
  • Information by UniProt

Images

  • ab158067 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up