Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11912
    • SpeciesHuman
    • SequenceLWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLG PGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRP FLDMGEGT
    • Molecular weight38 kDa including tags
    • Amino acids33 to 140
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Peptide Array

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • B lymphocyte-specific MB1 protein
    • B-cell antigen receptor complex-associated protein alpha chain
    • CD 79a
    • CD79a
    • CD79A antigen
    • CD79a antigen (immunoglobulin-associated alpha)
    • CD79a molecule, immunoglobulin-associated alpha
    • CD79A_HUMAN
    • Ig alpha
    • Ig-alpha
    • IGA
    • IgM-alpha
    • Immunoglobulin-associated alpha
    • Ly54
    • MB-1 membrane glycoprotein
    • MB1
    • Membrane-bound immunoglobulin-associated protein
    • Surface IgM-associated protein
    see all
  • FunctionRequired in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B cells.
  • Tissue specificityB-cells.
  • Involvement in diseaseDefects in CD79A are the cause of agammaglobulinemia type 3 (AGM3) [MIM:613501]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. Note=Two different mutations, one at the splice donor site of intron 2 and the other at the splice acceptor site for exon 3, have been identified. Both mutations give rise to a truncated protein.
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.
  • Cellular localizationCell membrane. Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
  • Information by UniProt

Recombinant Human CD79a protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD79a protein (ab112267)

ab112267 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"