Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSP RFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQ NESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQ LKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 229

Specifications

Our Abpromise guarantee covers the use of ab114420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGM6
    • B cell antigen receptor complex associated protein beta chain
    • B cell specific glycoprotein B29
    • B-cell antigen receptor complex-associated protein beta chain
    • B-cell-specific glycoprotein B29
    • B29
    • B29/Ig-beta/CD79b
    • CD 79b
    • CD79b
    • CD79b antigen
    • CD79b antigen (immunoglobulin associated beta)
    • CD79b molecule
    • CD79b molecule immunoglobulin associated beta
    • CD79b protein
    • CD79B_HUMAN
    • Ig beta
    • Ig-beta
    • IGB
    • Igbeta
    • Immunoglobulin associated B29
    • Immunoglobulin associated B29 protein
    • Immunoglobulin associated beta
    • Immunoglobulin associated protein
    • Immunoglobulin-associated B29 protein
    • MGC108607
    see all
  • Function
    Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
  • Tissue specificity
    B-cells.
  • Involvement in disease
    Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6) [MIM:612692]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine upon B-cell activation.
  • Cellular localization
    Cell membrane. Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
  • Information by UniProt

Images

  • ab114420 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up