Recombinant Human CD8 alpha protein (ab114161)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01732
    • SpeciesHuman
    • SequenceSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLL YLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNS IMYFSHFVPV
    • Molecular weight38 kDa including tags
    • Amino acids22 to 131
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114161 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha polypeptide (p32)
    • CD8
    • CD8 antigen alpha polypeptide
    • CD8 antigen alpha polypeptide (p32)
    • CD8a
    • CD8A antigen
    • CD8A molecule
    • CD8A_HUMAN
    • Leu2
    • Leu2 T lymphocyte antigen
    • Ly3
    • LYT3
    • MAL
    • OKT8 T cell antigen
    • OTTHUMP00000160760
    • OTTHUMP00000160764
    • OTTHUMP00000203528
    • OTTHUMP00000203721
    • p32
    • T cell antigen Leu2
    • T cell co receptor
    • T-cell surface glycoprotein CD8 alpha chain
    • T-lymphocyte differentiation antigen T8/Leu-2
    • T8 T cell antigen
    • T8/Leu-2 T-lymphocyte differentiation antigen
    see all
  • FunctionIdentifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
  • Involvement in diseaseDefects in CD8A are a cause of familial CD8 deficiency (CD8 deficiency) [MIM:608957]. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.
  • Sequence similaritiesContains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    All of the five most carboxyl-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant Human CD8 alpha protein images

  • 12.5% SDS-PAGE analysis of ab114161, stained with Coomassie Blue.

References for Recombinant Human CD8 alpha protein (ab114161)

ab114161 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"