Recombinant Human CD8 beta protein (ab112264)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10966
    • SpeciesHuman
    • SequenceMRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNM RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI LNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTL KKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRA RLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
    • Molecular weight53 kDa including tags
    • Amino acids1 to 243
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD8b antigen
    • CD8 antigen beta polypeptide 1
    • CD8 antigen beta polypeptide 1 (p37)
    • CD8 beta
    • CD8b
    • CD8b molecule
    • CD8B_HUMAN
    • CD8B1
    • Leu2
    • Ly3
    • LYT3
    • MGC119115
    • P37
    • T cell surface glycoprotein CD8 beta chain
    • T lymphocyte surface glycoprotein beta chain
    • T-cell surface glycoprotein CD8 beta chain
    see all
  • FunctionIdentifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.
  • Tissue specificityIsoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.
  • Sequence similaritiesContains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Phosphorylated as a consequence of T-cell activation.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant Human CD8 beta protein images

  • ab112264 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD8 beta protein (ab112264)

ab112264 has not yet been referenced specifically in any publications.

Product Wall

Thank you for calling Abcam on Friday. For CD4, I have found the following set Protein: ab111463, fragment from 29-390. Antibodies: ab67480, aa7****                      ab51312, aa******* I know that the antibodies bind very close to each other, but t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"