Recombinant Human CD8 beta protein (ab112264)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNM RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI LNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTL KKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRA RLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
    • Molecular weight
      53 kDa including tags
    • Amino acids
      1 to 243
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD8b antigen
    • CD8 antigen beta polypeptide 1
    • CD8 antigen beta polypeptide 1 (p37)
    • CD8 beta
    • CD8b
    • CD8b molecule
    • CD8B_HUMAN
    • CD8B1
    • Leu2
    • Ly3
    • LYT3
    • MGC119115
    • P37
    • T cell surface glycoprotein CD8 beta chain
    • T lymphocyte surface glycoprotein beta chain
    • T-cell surface glycoprotein CD8 beta chain
    see all
  • Function
    Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.
  • Tissue specificity
    Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Phosphorylated as a consequence of T-cell activation.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab112264 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for calling Abcam on Friday. For CD4, I have found the following set Protein: ab111463, fragment from 29-390. Antibodies: ab67480, aa7****                      ab51312, aa******* I know that the antibodies bind very close to each other, but t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up