Overview

Description

  • Nature
    Recombinant
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSC GHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS IVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDF EIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK Extracellular domain (amino acids 1-241) of human B7.1 sequence is underlined. Human Fc sequence is in italics.
    • Amino acids
      1 to 241

Associated products

Specifications

Our Abpromise guarantee covers the use of ab73007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form
    Liquid
  • Additional notes
    Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.


    CD80-Fc fusion protein alone or in combination with anti-CD4+ or CD25+ depletion (depletion of Tregs) has been used in animal models to inhibit tumor growth.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.2

General Info

  • Alternative names
    • Activation B7-1 antigen
    • B lymphocyte activation antigen B7
    • B7
    • B7-1
    • B7-1 antigen
    • B7.1
    • BB1
    • CD28 antigen ligand 1
    • CD28LG
    • CD28LG1
    • CD80
    • CD80 antigen
    • CD80 antigen (CD28 antigen ligand 1, B7-1 antigen)
    • CD80 molecule
    • CD80_HUMAN
    • Costimulatory factor CD80
    • costimulatory molecule variant IgV-CD80
    • CTLA-4 counter-receptor B7.1
    • LAB7
    • T-lymphocyte activation antigen CD80
    see all
  • Function
    Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
  • Tissue specificity
    Expressed on activated B-cells, macrophages and dendritic cells.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab73007 to demonstrate purity of protein.
  • Effect of ab73007 on the growth of tumor cells. ab73007 prevents growth of a mouse solid tumor, RENCA. The immunotherapy is more more effective in combination with CD25+ depletion and ab73007.

References

ab73007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up