Overview

Description

  • NatureRecombinant
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSC GHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS IVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDF EIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK Extracellular domain (amino acids 1-241) of human B7.1 sequence is underlined. Human Fc sequence is in italics.
    • Amino acids1 to 241

Associated products

Specifications

Our Abpromise guarantee covers the use of ab73007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • FormLiquid
  • Additional notesEndotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.


    CD80-Fc fusion protein alone or in combination with anti-CD4+ or CD25+ depletion (depletion of Tregs) has been used in animal models to inhibit tumor growth.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.2

General Info

  • Alternative names
    • Activation B7-1 antigen
    • B lymphocyte activation antigen B7
    • B7
    • B7-1
    • B7-1 antigen
    • B7.1
    • BB1
    • CD28 antigen ligand 1
    • CD28LG
    • CD28LG1
    • CD80
    • CD80 antigen
    • CD80 antigen (CD28 antigen ligand 1, B7-1 antigen)
    • CD80 molecule
    • CD80_HUMAN
    • Costimulatory factor CD80
    • costimulatory molecule variant IgV-CD80
    • CTLA-4 counter-receptor B7.1
    • LAB7
    • T-lymphocyte activation antigen CD80
    see all
  • FunctionInvolved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
  • Tissue specificityExpressed on activated B-cells, macrophages and dendritic cells.
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD80 protein images

  • SDS-PAGE analysis of ab73007 to demonstrate purity of protein.
  • Effect of ab73007 on the growth of tumor cells. ab73007 prevents growth of a mouse solid tumor, RENCA. The immunotherapy is more more effective in combination with CD25+ depletion and ab73007.

References for Recombinant Human CD80 protein (ab73007)

ab73007 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"