Overview

  • Product nameRecombinant Human CD82 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP27701
    • SpeciesHuman
    • SequenceMGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSS SLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQV TAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCC GWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRT QSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIVELLGMVLSI CLCRHVHSEDYSKVPKY
    • Molecular weight55 kDa including tags
    • Amino acids1 to 267

Specifications

Our Abpromise guarantee covers the use of ab114340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4F9
    • Antigen detected by monoclonal and antibody IA4
    • C33
    • C33 antigen
    • CD 82
    • CD82
    • CD82 antigen
    • CD82 molecule
    • CD82_HUMAN
    • GR 15
    • GR15
    • IA 4
    • IA4
    • Inducible membrane protein
    • Inducible membrane protein R2
    • KAI 1
    • KAI1
    • Kangai 1
    • Kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4))
    • Kangai1
    • Leukocyte surface antigen R2
    • Metastasis suppressor Kangai 1
    • Metastasis suppressor Kangai-1
    • Metastasis suppressor Kangai1
    • Prostate cancer antimetastasis gene KAI1
    • R2
    • R2 leukocyte antigen
    • SAR 2
    • SAR2
    • ST 6
    • ST6
    • Suppression of tumorigenicity 6
    • Suppression of tumorigenicity 6 prostate
    • Suppressor of tumorigenicity 6
    • Suppressor of tumorigenicity 6 protein
    • Tetraspanin 27
    • Tetraspanin-27
    • Tetraspanin27
    • Tspan 27
    • Tspan-27
    • Tspan27
    see all
  • FunctionAssociates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
  • Tissue specificityLymphoid specific.
  • Sequence similaritiesBelongs to the tetraspanin (TM4SF) family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD82 protein images

  • ab114340 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD82 protein (ab114340)

ab114340 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"