Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLR GQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLS GKVILRVTGCPAQRKEETFKKYRAVDHHHHHH
    • Molecular weight
      15 kDa including tags
    • Amino acids
      20 to 143
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151946 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • B cell activation 45kDa cell surface glycoprotein Ig superfamily
    • B cell activation protein
    • B-cell activation protein
    • BL11
    • BL11 PEN
    • CD83
    • CD83 antigen
    • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
    • CD83 molecule
    • CD83_HUMAN
    • Cell surface glycoprotein
    • Cell surface protein HB15
    • HB15
    • hCD83
    see all
  • Function
    May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
  • Tissue specificity
    Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab151946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up