Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGR RLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLY GKPFLSADRG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      24 to 133

Specifications

Our Abpromise guarantee covers the use of ab114478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD89
    • Fc alpha receptor
    • Fc fragment of IgA, receptor for
    • FCAR
    • FCAR_HUMAN
    • IgA Fc receptor
    • Immunoglobulin alpha Fc receptor
    see all
  • Function
    Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.
  • Tissue specificity
    Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar macrophages; however only one isoform is expressed at alveolar macrophages surfaces.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114478 at approximately 37.73kDa stained with Coomassie Blue.

References

ab114478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up