Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLAL WDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP ELTFGKGTQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      23 to 131

Specifications

Our Abpromise guarantee covers the use of ab114162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114162 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD_antigen=CD8b
    • CD8 antigen 37 kDa chain
    • CD8 antigen, beta chain
    • CD8 antigen, beta polypeptide 1
    • CD8 antigen, beta polypeptide 1 (p37)
    • CD8B
    • CD8b molecule
    • CD8B1
    • Flags: Precursor
    • LEU2
    • LY3
    • LYT3
    • MGC119115
    • OTTHUMP00000160762
    • OTTHUMP00000160763
    • OX 8 membrane antigen
    • P37
    • T cell surface glycoprotein CD8
    • T cell surface glycoprotein CD8 beta chain
    • T lymphocyte surface glycoprotein beta chain
    see all
  • Cellular localization
    Isoform 1: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 2: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 3: Secreted (Probable). Isoform 4: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 5: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 6: Secreted (Probable). Isoform 7: Secreted (Probable). Isoform 8: Secreted (Probable).

Recombinant Human CD8B protein images

  • 12.5% SDS-PAGE analysis of ab114162, stained with Coomassie Blue.

References for Recombinant Human CD8B protein (ab114162)

ab114162 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up