Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLAL WDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP ELTFGKGTQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      23 to 131

Specifications

Our Abpromise guarantee covers the use of ab114162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114162 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD_antigen=CD8b
    • CD8 antigen 37 kDa chain
    • CD8 antigen, beta chain
    • CD8 antigen, beta polypeptide 1
    • CD8 antigen, beta polypeptide 1 (p37)
    • CD8B
    • CD8b molecule
    • CD8B1
    • Flags: Precursor
    • LEU2
    • LY3
    • LYT3
    • MGC119115
    • OTTHUMP00000160762
    • OTTHUMP00000160763
    • OX 8 membrane antigen
    • P37
    • T cell surface glycoprotein CD8
    • T cell surface glycoprotein CD8 beta chain
    • T lymphocyte surface glycoprotein beta chain
    see all
  • Cellular localization
    Isoform 1: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 2: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 3: Secreted (Probable). Isoform 4: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 5: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 6: Secreted (Probable). Isoform 7: Secreted (Probable). Isoform 8: Secreted (Probable).

Images

  • 12.5% SDS-PAGE analysis of ab114162, stained with Coomassie Blue.

References

ab114162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up