Recombinant Human CD8B protein (denatured) (ab177613)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLS NMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASR FILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKS TLKKRVCRLPRPETQKGPLCSP
    • Molecular weight
      19 kDa including tags
    • Amino acids
      22 to 170
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_004922 (Extracellular domain).

Specifications

Our Abpromise guarantee covers the use of ab177613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • CD_antigen=CD8b
    • CD8 antigen 37 kDa chain
    • CD8 antigen, beta chain
    • CD8 antigen, beta polypeptide 1
    • CD8 antigen, beta polypeptide 1 (p37)
    • CD8B
    • CD8b molecule
    • CD8B1
    • Flags: Precursor
    • LEU2
    • LY3
    • LYT3
    • MGC119115
    • OTTHUMP00000160762
    • OTTHUMP00000160763
    • OX 8 membrane antigen
    • P37
    • T cell surface glycoprotein CD8
    • T cell surface glycoprotein CD8 beta chain
    • T lymphocyte surface glycoprotein beta chain
    see all
  • Cellular localization
    Isoform 1: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 2: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 3: Secreted (Probable). Isoform 4: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 5: Cell membrane; Single-pass type I membrane protein (Probable). Isoform 6: Secreted (Probable). Isoform 7: Secreted (Probable). Isoform 8: Secreted (Probable).

Images

  • 15% SDS-PAGE analysis of ab177613 (3µg).

References

ab177613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up