Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETN NNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIF AIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAL NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVG IGIAVVMIFGMIFSMILCCAIRRNREMV
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 228

Specifications

Our Abpromise guarantee covers the use of ab152262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Tetraspanin 29
    • 5H9
    • 5H9 antigen
    • Antigen defined by monoclonal antibody 602 29
    • Antigen defined by monoclonal antibody 60229
    • BA-2/p24 antigen
    • BA2
    • BTCC 1
    • BTCC1
    • CD9
    • CD9 antigen
    • CD9 antigen p24
    • CD9 molecule
    • CD9_HUMAN
    • Cell growth inhibiting gene 2 protein
    • Cell growth-inhibiting gene 2 protein
    • DRAP 27
    • DRAP27
    • GIG2
    • Growth inhibiting gene 2 protein
    • Leukocyte antigen MIC3
    • MIC3
    • Motility related protein
    • Motility-related protein
    • MRP 1
    • MRP-1
    • MRP1
    • p24
    • p24 antigen
    • Tetraspanin-29
    • Tspan 29
    • Tspan-29
    • TSPAN29
    see all
  • Function
    Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.
  • Tissue specificity
    Expressed by a variety of hematopoietic and epithelial cells.
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Post-translational
    modifications
    Protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up