Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQ RVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDT PYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGS NIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANV ACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQ DCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHG KNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGY EPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGT QCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVS LGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSS DAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNN DGTDGQKVDHHHHHH
    • Molecular weight
      59 kDa
    • Amino acids
      24 to 580
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • C1q receptor 1
    • C1q/MBL/SPA receptor
    • C1qR
    • C1qR(p)
    • C1qr1
    • C1QR1_HUMAN
    • C1qRp
    • CD93
    • CD93 antigen
    • CD93 molecule
    • CDw93
    • Complement component 1 q subcomponent receptor 1
    • Complement component C1q receptor
    • dJ737E23.1
    • ECSM3
    • Matrix remodeling associated protein 4
    • Matrix remodelling associated 4
    • Matrix-remodeling-associated protein 4
    • MXRA4
    see all
  • Function
    Receptor (or element of a larger receptor complex) for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). May mediate the enhancement of phagocytosis in monocytes and macrophages upon interaction with soluble defense collagens. May play a role in intercellular adhesion.
  • Tissue specificity
    Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
  • Sequence similarities
    Contains 1 C-type lectin domain.
    Contains 5 EGF-like domains.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab151854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up