Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRR EAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKEL RNSCISKR
    • Amino acids
      33 to 140
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1q receptor 1
    • C1q/MBL/SPA receptor
    • C1qR
    • C1qR(p)
    • C1qr1
    • C1QR1_HUMAN
    • C1qRp
    • CD93
    • CD93 antigen
    • CD93 molecule
    • CDw93
    • Complement component 1 q subcomponent receptor 1
    • Complement component C1q receptor
    • dJ737E23.1
    • ECSM3
    • Matrix remodeling associated protein 4
    • Matrix remodelling associated 4
    • Matrix-remodeling-associated protein 4
    • MXRA4
    see all
  • Function
    Receptor (or element of a larger receptor complex) for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). May mediate the enhancement of phagocytosis in monocytes and macrophages upon interaction with soluble defense collagens. May play a role in intercellular adhesion.
  • Tissue specificity
    Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
  • Sequence similarities
    Contains 1 C-type lectin domain.
    Contains 5 EGF-like domains.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161477 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up