Overview

  • Product nameRecombinant Human CD94 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13241
    • SpeciesHuman
    • SequenceMAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNI ELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQ NTDELDFMSSSRQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK NCIAYNPNGNALDESCEDKNRYICKQQLI
    • Molecular weight45 kDa including tags
    • Amino acids1 to 179

Specifications

Our Abpromise guarantee covers the use of ab114885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 94
    • CD94
    • CD94 antigen
    • Killer cell lectin like receptor subfamily D member 1
    • Killer cell lectin-like receptor subfamily D member 1
    • KLRD 1
    • KLRD1
    • KLRD1 protein
    • KLRD1_HUMAN
    • KP 43
    • KP43
    • Natural killer cells antigen CD94
    • NK cell receptor
    • OTTHUMP00000238754
    • OTTHUMP00000238755
    • OTTHUMP00000238756
    • OTTHUMP00000238758
    • OTTHUMP00000239093
    see all
  • FunctionPlays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
  • Tissue specificityNatural killer cells.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD94 protein images

  • 12.5% SDS-PAGE showing ab114885 at approximately 45.10kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CD94 protein (ab114885)

ab114885 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"