Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP48960
    • SpeciesHuman
    • SequenceKKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLE SSDGEAGRDPPAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKN GSTTCQCSH
    • Molecular weight38 kDa including tags
    • Amino acids421 to 529

Specifications

Our Abpromise guarantee covers the use of ab114866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADGRE5
    • Adhesion G protein-coupled receptor E5
    • CD 97
    • CD_antigen=CD97
    • CD97
    • CD97 antigen
    • CD97 antigen subunit beta
    • CD97 molecule
    • CD97_HUMAN
    • Leukocyte antigen CD97
    • Seven span transmembrane protein
    • Seven transmembrane helix receptor
    • Seven transmembrane heterodimeric receptor associated with inflammation
    • TM7LN 1
    • TM7LN1
    see all
  • FunctionReceptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
  • Tissue specificityBroadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and pancreatic carcinomas too. Expression are increased under inflammatory conditions in the CNS of multiple sclerosis and in synovial tissue of patients with rheumatoid arthritis. Increased expression of CD97 in the synovium is accompagnied by detectable levels of soluble CD97 in the synovial fluid.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 5 EGF-like domains.
    Contains 1 GPS domain.
  • DomainThe first two EGF domains mediate the interaction with DAF. A third tandemly arranged EGF domain is necessary for the structural integrity of the binding region.
    Binding to chondroitin sulfate is mediated by the fourth EGF domain.
  • Post-translational
    modifications
    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localizationCell membrane and Secreted > extracellular space.
  • Information by UniProt

Recombinant Human CD97 protein images

  • ab114866 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human CD97 protein (ab114866)

ab114866 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"