Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNP PKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      23 to 122
    • Additional sequence information
      FC tag at C terminus. Extracellular domain.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab186093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab186093 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

General Info

  • Alternative names
    • 12E7
    • Antigen identified by monoclonal 12E7, Y homolog
    • Antigen identified by monoclonal antibodies 12E7, F21 and O13
    • CD99
    • CD99 antigen
    • CD99 molecule
    • CD99_HUMAN
    • Cell surface antigen 12E7
    • Cell surface antigen HBA 71
    • Cell surface antigen O13
    • E2 antigen
    • HBA71
    • MIC 2X
    • MIC 2Y
    • MIC2
    • MIC2 (monoclonal antibody 12E7)
    • MIC2X
    • MIC2Y
    • MSK5X
    • Protein MIC2
    • Surface antigen MIC2
    • T cell surface glycoprotein E2
    • T-cell surface glycoprotein E2
    see all
  • Function
    Involved in T-cell adhesion processes. It is involved in spontaneous rosette formation with erythrocytes.
  • Sequence similarities
    Belongs to the CD99 family.
  • Post-translational
    modifications
    Extensively O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab186093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up