Recombinant Human CDA protein (ab99441)

Overview

  • Product nameRecombinant Human CDA protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP32320
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ
    • Molecular weight18 kDa including tags
    • Amino acids1 to 146
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99441 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 2mM EDTA, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CDD
    • Cytidine aminohydrolase
    • Cytidine deaminase
    • EC 3.5.4.5
  • RelevanceCDA (Cytidine deaminase) scavengers exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Growth inhibition of granulocyte-macrophage colony foring cells by human cytidine deaminase requires the catalytic function of the protein. It is highly expressed in granulocytes.

Recombinant Human CDA protein images

  • 15% SDS-PAGE showing ab99441 at approximately 18.3kDa (3µg).

References for Recombinant Human CDA protein (ab99441)

ab99441 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting Abcam regarding the ab99441.

I have had the opportunity to speak with the lab regarding your question. I have been told thatit may be active, but regrettably, it hasn’t been tested yet. Although it is scheduled...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"