Recombinant Human CDA protein (ab99441)

Overview

  • Product name
    Recombinant Human CDA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 146
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99441 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 2mM EDTA, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CDD
    • Cytidine aminohydrolase
    • Cytidine deaminase
    • EC 3.5.4.5
  • Relevance
    CDA (Cytidine deaminase) scavengers exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Growth inhibition of granulocyte-macrophage colony foring cells by human cytidine deaminase requires the catalytic function of the protein. It is highly expressed in granulocytes.

Images

  • 15% SDS-PAGE showing ab99441 at approximately 18.3kDa (3µg).

References

ab99441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting Abcam regarding the ab99441.

I have had the opportunity to speak with the lab regarding your question. I have been told thatit may be active, but regrettably, it hasn’t been tested yet. Although it is scheduled...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up