Overview

  • Product name
    Recombinant Human CDAN1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSL HQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
    • Amino acids
      1130 to 1227
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDA1
    • CDAI
    • CDAN1
    • CDAN1_HUMAN
    • Codanin
    • Codanin-1
    • Codanin1
    • PRO1295
    see all
  • Function
    Might be involved in nuclear membrane integrity.
  • Tissue specificity
    Ubiquitously expressed. Isoform 3 is not found in erythroid cells.
  • Involvement in disease
    Defects in CDAN1 are the cause of congenital dyserythropoietic anemia type 1 (CDA1) [MIM:224120]. An autosomal recessive blood disorder characterized by morphological abnormalities of erythroblasts, ineffective erythropoiesis, macrocytic anemia and secondary hemochromatosis. It is occasionally associated with bone abnormalities, especially of the hands and feet (acrodysostosis), nail hypoplasia, and scoliosis. Ultrastructural features include internuclear chromatin bridges connecting some nearly completely separated erythroblasts and an abnormal appearance (spongy or Swiss-cheese appearance) of the heterochromatin in a high proportion of the erythroblasts.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up