Recombinant Human Cdc14A protein (ab160093)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYA DFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIG AYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGI RKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKI ENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFI DGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEG SINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLR ALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFRLSSSLQGSAVTLKTSKM ALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKT SSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSSNSNGGNLNSP PGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY
    • Amino acids
      1 to 594
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC 10
    • Cdc 14
    • Cdc 14A
    • Cdc 14A1
    • Cdc 14A2
    • CDC10
    • CDC10 (cell division cycle 10, S. cerevisiae, homolog)
    • Cdc14
    • CDC14 cell division cycle 14 homolog A
    • CDC14 homolog A
    • Cdc14A1
    • Cdc14A2
    • Cell division cycle 14 homolog A
    • Cell division cycle 14, S. cerevisiae, homolog A
    • Cell division cycle 14A
    • Dual specificity protein phosphatase CDC 14A
    • Dual specificity protein phosphatase CDC14A
    • hCDC 14
    • hCDC14
    • OTTHUMP00000012653
    • OTTHUMP00000012654
    • OTTHUMP00000012655
    see all
  • Relevance
    Overproduction of hCdc14A leads to progressive cell death, accompanied by accumulation of pre-G1 DNA fragments and gradual elimination of cells at the G2/M transition. In 50% of the mitotic cells, multipolar mitotic spindles and misaggregated chromosomes are found. hCdc14A localizes to the centrosomes at the cell-cycle interphase stage. When the cell enters mitosis, this localization disappears suggesting that hCdc14A dissociates from the centrosomes at the G2/M transition. hCdc14A localizes to interphase centrosomes, but not to mitotic centrosomes, while hCdc14B localizes to the interphase nucleolus. Thus each isoform regulates separate cell cycle events. Cdc14A may affect cell cycle progression by its ability to dephosphorylate p53 at Ser315. This phosphatase activity is mediated by the interaction between the N-terminus of hCdc14A and the C-terminus of p53.
  • Cellular localization
    Cytoplasmic, Cytoskeleton, Nuclear.

Images

  • ab160093 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up